Hacon.de
Established in 1984, in Hannover, Germany, HaCon Ingenieurgesellschaft mbH employs a competent team of more than 100 experienced logisticians, traffic engineers, economic engineers, computer scientists and software engineers, who deliver customer...
Global Traffic Rank
Safety/Trust
Child Safety
Registered
Visitors / Day*
Pageviews / Day*
Website Worth*
Revenue / Day*
About Hacon.de
The domain Hacon.de belongs to the country-code Top-level domain .de. It holds a global ranking of 75,663 and is associated with the IPv4 address 213.83.5.144. The site has its servers located in Germany.
Trace an Email Address
Hacon.de Global Traffic Rank History
Explore the website's historical data on Global Traffic Rank and track its ranking trends over time.
Hacon.de Server Location
Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!
Germany
Hacon.de Website Information
Uncover the website's purpose and content, complemented by relevant focus keywords.
Website Summary
Hacon.de : Established in 1984, in Hannover, Germany, HaCon Ingenieurgesellschaft mbH employs a competent team of more than 100 experienced logisticians, traffic engineers, economic engineers, computer scientists and software engineers, who deliver customer and project-specific solutions with interdisciplinary teams. HaCon's software solutions are characterised by their highly innovative architecture and their ability to be modified quickly to fit new scenarios and customer-specific requirements.
Main Language
German
Inbound Links
162
Hacon.de Web Server
Discover essential Web Server Information: server software, page load time, and website language at your fingertips!
Webserver Software
Median Page Load Time
Hacon.de WHOIS Data
Discover comprehensive domain registration details and more with the accessible Whois data information right here!
Domain Registered
Domain Updated
Domain Expiry
Registrar
WHOIS Server
Domain Status
Nameservers
DNSSEC
Hacon.de DNS Resource Records
Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.
A Records
@ IN A 213.83.5.144
AAAA Records
No AAAA records could be found.
MX Records
@ IN MX 0 hacon-de.mail.protection.outlook.com
NS Records
@ IN NS gate-hacon.hacon.de
@ IN NS ns.plusline.de
@ IN NS ns.s.plusline.de
TXT Records
@ IN TXT "5TG-DS6-4W3"
@ IN TXT "apple-domain-verification=yICl3aZPo5x59c7l"
@ IN TXT "atlassian-domain-verification=PSIOvJg1+KN4QJ3YSBI5QJYsQk6WwuGAGuclATsGfa+jHcN8a3BVFI2mRaKcEfTV"
@ IN TXT "E3B-5TF-MJ3"
@ IN TXT "google-site-verification=BnGb8jbM_08ejQ_5QGVI6-qgsmY_XxqUVk_iLpXwOtU"
@ IN TXT "google-site-verification=xtkWtfgt57CEcKtuFn4u0MzSagBIeUEPKXCxyJqTFzg"
@ IN TXT "MS=ms52304121"
@ IN TXT "t5w80hl7dx0rpn4nv9jxgh7wo9xc7xyz"
@ IN TXT "v=spf1 ip4:213.83.5.128/26 ip4:83.246.89.10 ip6:2a02:790:1:9::a/64 include:spf.nl2go.com include:spf.protection.outlook.com include:_spf.salesforce.com -all"
SOA Record
@ IN SOA ns.hacon.de. hostmaster.hacon.de
(
2023052301 ; serial
28800 ; refresh (8 hours)
7200 ; retry (2 hours)
604800 ; expire (7 days)
86400 ; minimum (1 day)
)
Similar Domain Names like Hacon.de
Websites with similar domain names, indicating related or similar web addresses.
Similar Traffic Rank like Hacon.de
Websites that have comparable levels of popularity or visitor traffic.
- actividadesdeinfantilyprimaria.com 75661
- autocosmos.com.mx 75662
- hacon.de 75663
- enter.online 75664
- franchising.com 75665
Related Keywords
Explore related keywords for the domain name in search engines.
- http //hacon.de
- hacon de
- https //hacon.de
- hacon dot de
Hacon de Frequently Asked Questions (FAQ)
Unveiling the Most Asked Questions - Hacon.de Demystified!
Is the site safe, legit and trustworthy?
Currently we have not enough information to determine whether the site is safe, legit or trustworthy.
Is the site safe for children?
Currently we have not enough information to determine whether the site is safe for kids or not.
What is the domain about?
Established in 1984, in Hannover, Germany, HaCon Ingenieurgesellschaft mbH employs a competent team of more than 100 experienced logisticians, traffic engineers, economic engineers, computer scientists and software engineers, who deliver customer and project-specific solutions with interdisciplinary teams. HaCon's software solutions are characterised by their highly innovative architecture and their ability to be modified quickly to fit new scenarios and customer-specific requirements. ...
What is the IP address?
The hostname resolves to the IPv4 address 213.83.5.144.
When was the last WHOIS update?
The WHOIS entry was last updated 1906 days ago on Tuesday, February 5, 2019.
What are the domain's nameservers?
DNS is provided by the following nameservers:
- gate-hacon.hacon.de
- ns.plusline.de
- ns.s.plusline.de
What is the domain's traffic rank?
The site ranks 75,663 globally.
How many people visit the site each day?
The site receives approximately 710 visitors and 7.1 Thousand page impressions per day.
Where are the server locations?
The site has its servers located in Germany.
